Anti TBX3 pAb (ATL-HPA075876)

Atlas Antibodies

Catalog No.:
ATL-HPA075876-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: T-box 3
Gene Name: TBX3
Alternative Gene Name: TBX3-ISO, UMS, XHL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018604: 100%, ENSRNOG00000008706: 100%
Entrez Gene ID: 6926
Uniprot ID: O15119
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEP
Gene Sequence MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEP
Gene ID - Mouse ENSMUSG00000018604
Gene ID - Rat ENSRNOG00000008706
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBX3 pAb (ATL-HPA075876)
Datasheet Anti TBX3 pAb (ATL-HPA075876) Datasheet (External Link)
Vendor Page Anti TBX3 pAb (ATL-HPA075876) at Atlas Antibodies

Documents & Links for Anti TBX3 pAb (ATL-HPA075876)
Datasheet Anti TBX3 pAb (ATL-HPA075876) Datasheet (External Link)
Vendor Page Anti TBX3 pAb (ATL-HPA075876)