Anti TBRG1 pAb (ATL-HPA068022)

Atlas Antibodies

Catalog No.: ATL-HPA068022-25

Protein Description: transforming growth factor beta regulator 1
Gene Name: TBRG1
Alternative Gene Name: FLJ14621, NIAM, TB-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011114: 90%, ENSRNOG00000023850: 88%
Entrez Gene ID: 84897
Uniprot ID: Q3YBR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKENNKLEVLKKTCKKKKMAGGARKLVQPIALDPSGRPVFPIGLGGLTVYSL
• Gene Sequence: GKENNKLEVLKKTCKKKKMAGGARKLVQPIALDPSGRPVFPIGLGGLTVYSL
• Gene ID - Mouse: ENSMUSG00000011114
• Gene ID - Rat: ENSRNOG00000023850
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.