Anti TBPL1 pAb (ATL-HPA071813 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA071813-25
  • Immunohistochemistry analysis in human testis and liver tissues using Anti-TBPL1 antibody. Corresponding TBPL1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TBP-like 1
Gene Name: TBPL1
Alternative Gene Name: STUD, TLF, TLP, TRF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071359: 100%, ENSRNOG00000011114: 100%
Entrez Gene ID: 9519
Uniprot ID: P62380
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARR
Gene Sequence DADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARR
Gene ID - Mouse ENSMUSG00000071359
Gene ID - Rat ENSRNOG00000011114
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TBPL1 pAb (ATL-HPA071813 w/enhanced validation)
Datasheet Anti TBPL1 pAb (ATL-HPA071813 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TBPL1 pAb (ATL-HPA071813 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TBPL1 pAb (ATL-HPA071813 w/enhanced validation)
Datasheet Anti TBPL1 pAb (ATL-HPA071813 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TBPL1 pAb (ATL-HPA071813 w/enhanced validation)