Anti TBL3 pAb (ATL-HPA055695)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055695-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TBL3
Alternative Gene Name: SAZD, UTP13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040688: 89%, ENSRNOG00000013429: 88%
Entrez Gene ID:
Uniprot ID: Q12788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNILEVASGAVLRSLEQEDQEDITAFDLSPDNEVLVTASRALLLAQWAWQEGSVTRLWKAIHTAPVATMAFDPTST |
| Gene Sequence | RFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNILEVASGAVLRSLEQEDQEDITAFDLSPDNEVLVTASRALLLAQWAWQEGSVTRLWKAIHTAPVATMAFDPTST |
| Gene ID - Mouse | ENSMUSG00000040688 |
| Gene ID - Rat | ENSRNOG00000013429 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBL3 pAb (ATL-HPA055695) | |
| Datasheet | Anti TBL3 pAb (ATL-HPA055695) Datasheet (External Link) |
| Vendor Page | Anti TBL3 pAb (ATL-HPA055695) at Atlas Antibodies |
| Documents & Links for Anti TBL3 pAb (ATL-HPA055695) | |
| Datasheet | Anti TBL3 pAb (ATL-HPA055695) Datasheet (External Link) |
| Vendor Page | Anti TBL3 pAb (ATL-HPA055695) |