Anti TBL3 pAb (ATL-HPA055695)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055695-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TBL3
Alternative Gene Name: SAZD, UTP13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040688: 89%, ENSRNOG00000013429: 88%
Entrez Gene ID:
Uniprot ID: Q12788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNILEVASGAVLRSLEQEDQEDITAFDLSPDNEVLVTASRALLLAQWAWQEGSVTRLWKAIHTAPVATMAFDPTST |
Gene Sequence | RFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNILEVASGAVLRSLEQEDQEDITAFDLSPDNEVLVTASRALLLAQWAWQEGSVTRLWKAIHTAPVATMAFDPTST |
Gene ID - Mouse | ENSMUSG00000040688 |
Gene ID - Rat | ENSRNOG00000013429 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TBL3 pAb (ATL-HPA055695) | |
Datasheet | Anti TBL3 pAb (ATL-HPA055695) Datasheet (External Link) |
Vendor Page | Anti TBL3 pAb (ATL-HPA055695) at Atlas Antibodies |
Documents & Links for Anti TBL3 pAb (ATL-HPA055695) | |
Datasheet | Anti TBL3 pAb (ATL-HPA055695) Datasheet (External Link) |
Vendor Page | Anti TBL3 pAb (ATL-HPA055695) |