Anti TBL3 pAb (ATL-HPA055695)

Atlas Antibodies

Catalog No.:
ATL-HPA055695-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transducin (beta)-like 3
Gene Name: TBL3
Alternative Gene Name: SAZD, UTP13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040688: 89%, ENSRNOG00000013429: 88%
Entrez Gene ID:
Uniprot ID: Q12788
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNILEVASGAVLRSLEQEDQEDITAFDLSPDNEVLVTASRALLLAQWAWQEGSVTRLWKAIHTAPVATMAFDPTST
Gene Sequence RFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNILEVASGAVLRSLEQEDQEDITAFDLSPDNEVLVTASRALLLAQWAWQEGSVTRLWKAIHTAPVATMAFDPTST
Gene ID - Mouse ENSMUSG00000040688
Gene ID - Rat ENSRNOG00000013429
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBL3 pAb (ATL-HPA055695)
Datasheet Anti TBL3 pAb (ATL-HPA055695) Datasheet (External Link)
Vendor Page Anti TBL3 pAb (ATL-HPA055695) at Atlas Antibodies

Documents & Links for Anti TBL3 pAb (ATL-HPA055695)
Datasheet Anti TBL3 pAb (ATL-HPA055695) Datasheet (External Link)
Vendor Page Anti TBL3 pAb (ATL-HPA055695)