Anti TBL2 pAb (ATL-HPA051533)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051533-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TBL2
Alternative Gene Name: DKFZP43N024, WBSCR13, WS-betaTRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005374: 96%, ENSRNOG00000046252: 98%
Entrez Gene ID: 26608
Uniprot ID: Q9Y4P3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RIRKEKPQQHNFTHRLLAAALKSHSGNISCMDFSSNGKYLATCADDRTIRIWSTKDFLQREHRSMRANVELDHATLVRFSPDCRAFIVWLANGDTLRVFKMTKRE |
Gene Sequence | RIRKEKPQQHNFTHRLLAAALKSHSGNISCMDFSSNGKYLATCADDRTIRIWSTKDFLQREHRSMRANVELDHATLVRFSPDCRAFIVWLANGDTLRVFKMTKRE |
Gene ID - Mouse | ENSMUSG00000005374 |
Gene ID - Rat | ENSRNOG00000046252 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TBL2 pAb (ATL-HPA051533) | |
Datasheet | Anti TBL2 pAb (ATL-HPA051533) Datasheet (External Link) |
Vendor Page | Anti TBL2 pAb (ATL-HPA051533) at Atlas Antibodies |
Documents & Links for Anti TBL2 pAb (ATL-HPA051533) | |
Datasheet | Anti TBL2 pAb (ATL-HPA051533) Datasheet (External Link) |
Vendor Page | Anti TBL2 pAb (ATL-HPA051533) |