Anti TBKBP1 pAb (ATL-HPA064856)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064856-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TBKBP1
Alternative Gene Name: KIAA0775, ProSAPiP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038517: 96%, ENSRNOG00000009370: 94%
Entrez Gene ID: 9755
Uniprot ID: A7MCY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSG |
| Gene Sequence | ELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSG |
| Gene ID - Mouse | ENSMUSG00000038517 |
| Gene ID - Rat | ENSRNOG00000009370 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBKBP1 pAb (ATL-HPA064856) | |
| Datasheet | Anti TBKBP1 pAb (ATL-HPA064856) Datasheet (External Link) |
| Vendor Page | Anti TBKBP1 pAb (ATL-HPA064856) at Atlas Antibodies |
| Documents & Links for Anti TBKBP1 pAb (ATL-HPA064856) | |
| Datasheet | Anti TBKBP1 pAb (ATL-HPA064856) Datasheet (External Link) |
| Vendor Page | Anti TBKBP1 pAb (ATL-HPA064856) |