Anti TBKBP1 pAb (ATL-HPA064856)

Atlas Antibodies

Catalog No.:
ATL-HPA064856-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TBK1 binding protein 1
Gene Name: TBKBP1
Alternative Gene Name: KIAA0775, ProSAPiP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038517: 96%, ENSRNOG00000009370: 94%
Entrez Gene ID: 9755
Uniprot ID: A7MCY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSG
Gene Sequence ELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSG
Gene ID - Mouse ENSMUSG00000038517
Gene ID - Rat ENSRNOG00000009370
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBKBP1 pAb (ATL-HPA064856)
Datasheet Anti TBKBP1 pAb (ATL-HPA064856) Datasheet (External Link)
Vendor Page Anti TBKBP1 pAb (ATL-HPA064856) at Atlas Antibodies

Documents & Links for Anti TBKBP1 pAb (ATL-HPA064856)
Datasheet Anti TBKBP1 pAb (ATL-HPA064856) Datasheet (External Link)
Vendor Page Anti TBKBP1 pAb (ATL-HPA064856)