Anti TBC1D9 pAb (ATL-HPA006503)

Atlas Antibodies

Catalog No.:
ATL-HPA006503-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 9 (with GRAM domain)
Gene Name: TBC1D9
Alternative Gene Name: KIAA0882, MDR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031709: 84%, ENSRNOG00000003496: 83%
Entrez Gene ID: 23158
Uniprot ID: Q6ZT07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGKLFVAQPAKEGGSGGSGPSCHQGIPGVLFPKKGPGQPYVVESVEPLPASLAPDSEEHSLGGQMEDIKLEDSSPRDNGACSSMLISDDDTKDDSSMSSYSVLSAGSHEEDKLHCEDI
Gene Sequence VGKLFVAQPAKEGGSGGSGPSCHQGIPGVLFPKKGPGQPYVVESVEPLPASLAPDSEEHSLGGQMEDIKLEDSSPRDNGACSSMLISDDDTKDDSSMSSYSVLSAGSHEEDKLHCEDI
Gene ID - Mouse ENSMUSG00000031709
Gene ID - Rat ENSRNOG00000003496
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D9 pAb (ATL-HPA006503)
Datasheet Anti TBC1D9 pAb (ATL-HPA006503) Datasheet (External Link)
Vendor Page Anti TBC1D9 pAb (ATL-HPA006503) at Atlas Antibodies

Documents & Links for Anti TBC1D9 pAb (ATL-HPA006503)
Datasheet Anti TBC1D9 pAb (ATL-HPA006503) Datasheet (External Link)
Vendor Page Anti TBC1D9 pAb (ATL-HPA006503)