Anti TBC1D9 pAb (ATL-HPA000262)

Atlas Antibodies

Catalog No.: ATL-HPA000262-25

Protein Description: TBC1 domain family, member 9 (with GRAM domain)
Gene Name: TBC1D9
Alternative Gene Name: KIAA0882, MDR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031709: 94%, ENSRNOG00000003496: 92%
Entrez Gene ID: 23158
Uniprot ID: Q6ZT07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDSLINFREFVSGLSAACHGDLTEKLKLLYKMHVLPEPSSDQDEPDSAFEATQYFFEDITPECTHVVGLDSRSKQGADDGFVTVSLKPDKGKRANSQENRNYLRLW
• Gene Sequence: GDSLINFREFVSGLSAACHGDLTEKLKLLYKMHVLPEPSSDQDEPDSAFEATQYFFEDITPECTHVVGLDSRSKQGADDGFVTVSLKPDKGKRANSQENRNYLRLW
• Gene ID - Mouse: ENSMUSG00000031709
• Gene ID - Rat: ENSRNOG00000003496
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TBC1D9 pAb (ATL-HPA000262) – 1 Found

Kothari, Charu; Clemenceau, Alisson; Ouellette, Geneviève; Ennour-Idrissi, Kaoutar; Michaud, Annick; C-Gaudreault, René; Diorio, Caroline; Durocher, Francine. TBC1D9: An Important Modulator of Tumorigenesis in Breast Cancer. Cancers. 2021;13(14)