Anti TBC1D4 pAb (ATL-HPA059885)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059885-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TBC1D4
Alternative Gene Name: AS160, DKFZp779C0666, KIAA0603
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033083: 87%, ENSRNOG00000009431: 87%
Entrez Gene ID: 9882
Uniprot ID: O60343
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMAEIRRRSQKPE |
| Gene Sequence | MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMAEIRRRSQKPE |
| Gene ID - Mouse | ENSMUSG00000033083 |
| Gene ID - Rat | ENSRNOG00000009431 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBC1D4 pAb (ATL-HPA059885) | |
| Datasheet | Anti TBC1D4 pAb (ATL-HPA059885) Datasheet (External Link) |
| Vendor Page | Anti TBC1D4 pAb (ATL-HPA059885) at Atlas Antibodies |
| Documents & Links for Anti TBC1D4 pAb (ATL-HPA059885) | |
| Datasheet | Anti TBC1D4 pAb (ATL-HPA059885) Datasheet (External Link) |
| Vendor Page | Anti TBC1D4 pAb (ATL-HPA059885) |