Anti TBC1D4 pAb (ATL-HPA059885)

Atlas Antibodies

Catalog No.:
ATL-HPA059885-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 4
Gene Name: TBC1D4
Alternative Gene Name: AS160, DKFZp779C0666, KIAA0603
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033083: 87%, ENSRNOG00000009431: 87%
Entrez Gene ID: 9882
Uniprot ID: O60343
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMAEIRRRSQKPE
Gene Sequence MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMAEIRRRSQKPE
Gene ID - Mouse ENSMUSG00000033083
Gene ID - Rat ENSRNOG00000009431
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D4 pAb (ATL-HPA059885)
Datasheet Anti TBC1D4 pAb (ATL-HPA059885) Datasheet (External Link)
Vendor Page Anti TBC1D4 pAb (ATL-HPA059885) at Atlas Antibodies

Documents & Links for Anti TBC1D4 pAb (ATL-HPA059885)
Datasheet Anti TBC1D4 pAb (ATL-HPA059885) Datasheet (External Link)
Vendor Page Anti TBC1D4 pAb (ATL-HPA059885)