Anti TBC1D2B pAb (ATL-HPA052663)

Atlas Antibodies

Catalog No.: ATL-HPA052663-25

Protein Description: TBC1 domain family, member 2B
Gene Name: TBC1D2B
Alternative Gene Name: KIAA1055
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037410: 85%, ENSRNOG00000014543: 85%
Entrez Gene ID: 23102
Uniprot ID: Q9UPU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VRSSQYDKYFTSSRLCGGVPKDTLELLHQKDDQILGLTSQLERFSLEKESLQQEVRTLKSKVGELNEQLGMLMETIQAKDE
• Gene Sequence: VRSSQYDKYFTSSRLCGGVPKDTLELLHQKDDQILGLTSQLERFSLEKESLQQEVRTLKSKVGELNEQLGMLMETIQAKDE
• Gene ID - Mouse: ENSMUSG00000037410
• Gene ID - Rat: ENSRNOG00000014543
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TBC1D2B pAb (ATL-HPA052663) – 1 Found

Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094.