Anti TBC1D2B pAb (ATL-HPA041833)

Atlas Antibodies

Catalog No.: ATL-HPA041833-25

Protein Description: TBC1 domain family member 2B
Gene Name: TBC1D2B
Alternative Gene Name: KIAA1055
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037410: 87%, ENSRNOG00000014543: 89%
Entrez Gene ID: 23102
Uniprot ID: Q9UPU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YWLQELQQKRWEYCNSLDMVKWDSRTSPTPGDFPKGLVARDNTDLIYPHPNASAEKARNVLAVETVPGELVGEQAANQPAPGHPNSINFYSLKQWGNE
• Gene Sequence: YWLQELQQKRWEYCNSLDMVKWDSRTSPTPGDFPKGLVARDNTDLIYPHPNASAEKARNVLAVETVPGELVGEQAANQPAPGHPNSINFYSLKQWGNE
• Gene ID - Mouse: ENSMUSG00000037410
• Gene ID - Rat: ENSRNOG00000014543
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.