Anti TBC1D29 pAb (ATL-HPA059178)
Atlas Antibodies
- SKU:
- ATL-HPA059178-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TBC1D29
Alternative Gene Name: DKFZP434O047
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042978: 30%, ENSRNOG00000057696: 30%
Entrez Gene ID: 26083
Uniprot ID: Q9UFV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CLWDMYLLEGEQMLMLITSIAFKVQRSLYEETNKETWGPATPRALKGTGRARPICESL |
Gene Sequence | CLWDMYLLEGEQMLMLITSIAFKVQRSLYEETNKETWGPATPRALKGTGRARPICESL |
Gene ID - Mouse | ENSMUSG00000042978 |
Gene ID - Rat | ENSRNOG00000057696 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TBC1D29 pAb (ATL-HPA059178) | |
Datasheet | Anti TBC1D29 pAb (ATL-HPA059178) Datasheet (External Link) |
Vendor Page | Anti TBC1D29 pAb (ATL-HPA059178) at Atlas Antibodies |
Documents & Links for Anti TBC1D29 pAb (ATL-HPA059178) | |
Datasheet | Anti TBC1D29 pAb (ATL-HPA059178) Datasheet (External Link) |
Vendor Page | Anti TBC1D29 pAb (ATL-HPA059178) |