Anti TBC1D29 pAb (ATL-HPA059178)

Atlas Antibodies

Catalog No.: ATL-HPA059178-25

Protein Description: TBC1 domain family, member 29
Gene Name: TBC1D29
Alternative Gene Name: DKFZP434O047
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042978: 30%, ENSRNOG00000057696: 30%
Entrez Gene ID: 26083
Uniprot ID: Q9UFV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLWDMYLLEGEQMLMLITSIAFKVQRSLYEETNKETWGPATPRALKGTGRARPICESL
• Gene Sequence: CLWDMYLLEGEQMLMLITSIAFKVQRSLYEETNKETWGPATPRALKGTGRARPICESL
• Gene ID - Mouse: ENSMUSG00000042978
• Gene ID - Rat: ENSRNOG00000057696
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.