Anti TBC1D29 pAb (ATL-HPA059178)

Atlas Antibodies

SKU:
ATL-HPA059178-25
  • Immunohistochemical staining of human esophagus shows moderate nucleolar positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 29
Gene Name: TBC1D29
Alternative Gene Name: DKFZP434O047
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042978: 30%, ENSRNOG00000057696: 30%
Entrez Gene ID: 26083
Uniprot ID: Q9UFV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLWDMYLLEGEQMLMLITSIAFKVQRSLYEETNKETWGPATPRALKGTGRARPICESL
Gene Sequence CLWDMYLLEGEQMLMLITSIAFKVQRSLYEETNKETWGPATPRALKGTGRARPICESL
Gene ID - Mouse ENSMUSG00000042978
Gene ID - Rat ENSRNOG00000057696
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TBC1D29 pAb (ATL-HPA059178)
Datasheet Anti TBC1D29 pAb (ATL-HPA059178) Datasheet (External Link)
Vendor Page Anti TBC1D29 pAb (ATL-HPA059178) at Atlas Antibodies

Documents & Links for Anti TBC1D29 pAb (ATL-HPA059178)
Datasheet Anti TBC1D29 pAb (ATL-HPA059178) Datasheet (External Link)
Vendor Page Anti TBC1D29 pAb (ATL-HPA059178)