Anti TBC1D24 pAb (ATL-HPA068080)

Atlas Antibodies

Catalog No.:
ATL-HPA068080-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 24
Gene Name: TBC1D24
Alternative Gene Name: DFNA65, DFNB86, KIAA1171, TLDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036473: 95%, ENSRNOG00000052204: 95%
Entrez Gene ID: 57465
Uniprot ID: Q9ULP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDLNRGRTSHCDTFNNQPLCSENFLIAAVEAWGFQDPD
Gene Sequence ARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDLNRGRTSHCDTFNNQPLCSENFLIAAVEAWGFQDPD
Gene ID - Mouse ENSMUSG00000036473
Gene ID - Rat ENSRNOG00000052204
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D24 pAb (ATL-HPA068080)
Datasheet Anti TBC1D24 pAb (ATL-HPA068080) Datasheet (External Link)
Vendor Page Anti TBC1D24 pAb (ATL-HPA068080) at Atlas Antibodies

Documents & Links for Anti TBC1D24 pAb (ATL-HPA068080)
Datasheet Anti TBC1D24 pAb (ATL-HPA068080) Datasheet (External Link)
Vendor Page Anti TBC1D24 pAb (ATL-HPA068080)