Anti TBC1D2 pAb (ATL-HPA076521)

Atlas Antibodies

Catalog No.: ATL-HPA076521-25

Protein Description: TBC1 domain family member 2
Gene Name: TBC1D2
Alternative Gene Name: Armus, PARIS1, TBC1D2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039813: 83%, ENSRNOG00000023348: 85%
Entrez Gene ID: 55357
Uniprot ID: Q9BYX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEALGDEASECSELLRQLVQEALQWEAGEASSDSIELSPISKYDEYGFLTVPDYEVEDLKLL
• Gene Sequence: VAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEALGDEASECSELLRQLVQEALQWEAGEASSDSIELSPISKYDEYGFLTVPDYEVEDLKLL
• Gene ID - Mouse: ENSMUSG00000039813
• Gene ID - Rat: ENSRNOG00000023348
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.