Anti TBC1D2 pAb (ATL-HPA076521)

Atlas Antibodies

Catalog No.:
ATL-HPA076521-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family member 2
Gene Name: TBC1D2
Alternative Gene Name: Armus, PARIS1, TBC1D2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039813: 83%, ENSRNOG00000023348: 85%
Entrez Gene ID: 55357
Uniprot ID: Q9BYX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEALGDEASECSELLRQLVQEALQWEAGEASSDSIELSPISKYDEYGFLTVPDYEVEDLKLL
Gene Sequence VAEKEKALLTKCAYLQARNCQVESKYLAGLRRLQEALGDEASECSELLRQLVQEALQWEAGEASSDSIELSPISKYDEYGFLTVPDYEVEDLKLL
Gene ID - Mouse ENSMUSG00000039813
Gene ID - Rat ENSRNOG00000023348
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D2 pAb (ATL-HPA076521)
Datasheet Anti TBC1D2 pAb (ATL-HPA076521) Datasheet (External Link)
Vendor Page Anti TBC1D2 pAb (ATL-HPA076521) at Atlas Antibodies

Documents & Links for Anti TBC1D2 pAb (ATL-HPA076521)
Datasheet Anti TBC1D2 pAb (ATL-HPA076521) Datasheet (External Link)
Vendor Page Anti TBC1D2 pAb (ATL-HPA076521)