Anti TBC1D17 pAb (ATL-HPA068119)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068119-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TBC1D17
Alternative Gene Name: FLJ12168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038520: 80%, ENSRNOG00000020191: 82%
Entrez Gene ID: 79735
Uniprot ID: Q9HA65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQILFSKKDSSGGDSCASEEEPTFDPGYEPDWAVISTVRPQLCHSEPTRGAEPSC |
| Gene Sequence | GVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQILFSKKDSSGGDSCASEEEPTFDPGYEPDWAVISTVRPQLCHSEPTRGAEPSC |
| Gene ID - Mouse | ENSMUSG00000038520 |
| Gene ID - Rat | ENSRNOG00000020191 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBC1D17 pAb (ATL-HPA068119) | |
| Datasheet | Anti TBC1D17 pAb (ATL-HPA068119) Datasheet (External Link) |
| Vendor Page | Anti TBC1D17 pAb (ATL-HPA068119) at Atlas Antibodies |
| Documents & Links for Anti TBC1D17 pAb (ATL-HPA068119) | |
| Datasheet | Anti TBC1D17 pAb (ATL-HPA068119) Datasheet (External Link) |
| Vendor Page | Anti TBC1D17 pAb (ATL-HPA068119) |