Anti TBC1D17 pAb (ATL-HPA068119)

Atlas Antibodies

Catalog No.:
ATL-HPA068119-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 17
Gene Name: TBC1D17
Alternative Gene Name: FLJ12168
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038520: 80%, ENSRNOG00000020191: 82%
Entrez Gene ID: 79735
Uniprot ID: Q9HA65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQILFSKKDSSGGDSCASEEEPTFDPGYEPDWAVISTVRPQLCHSEPTRGAEPSC
Gene Sequence GVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQILFSKKDSSGGDSCASEEEPTFDPGYEPDWAVISTVRPQLCHSEPTRGAEPSC
Gene ID - Mouse ENSMUSG00000038520
Gene ID - Rat ENSRNOG00000020191
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D17 pAb (ATL-HPA068119)
Datasheet Anti TBC1D17 pAb (ATL-HPA068119) Datasheet (External Link)
Vendor Page Anti TBC1D17 pAb (ATL-HPA068119) at Atlas Antibodies

Documents & Links for Anti TBC1D17 pAb (ATL-HPA068119)
Datasheet Anti TBC1D17 pAb (ATL-HPA068119) Datasheet (External Link)
Vendor Page Anti TBC1D17 pAb (ATL-HPA068119)