Anti TBC1D14 pAb (ATL-HPA067398)

Atlas Antibodies

Catalog No.:
ATL-HPA067398-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 14
Gene Name: TBC1D14
Alternative Gene Name: KIAA1322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029192: 89%, ENSRNOG00000006400: 90%
Entrez Gene ID: 57533
Uniprot ID: Q9P2M4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APPAPSSTEREQSVRKSSTFPRTGYDSVKLYSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNEDILDLVVTSSSSAIVTLENDDDP
Gene Sequence APPAPSSTEREQSVRKSSTFPRTGYDSVKLYSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNEDILDLVVTSSSSAIVTLENDDDP
Gene ID - Mouse ENSMUSG00000029192
Gene ID - Rat ENSRNOG00000006400
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D14 pAb (ATL-HPA067398)
Datasheet Anti TBC1D14 pAb (ATL-HPA067398) Datasheet (External Link)
Vendor Page Anti TBC1D14 pAb (ATL-HPA067398) at Atlas Antibodies

Documents & Links for Anti TBC1D14 pAb (ATL-HPA067398)
Datasheet Anti TBC1D14 pAb (ATL-HPA067398) Datasheet (External Link)
Vendor Page Anti TBC1D14 pAb (ATL-HPA067398)