Anti TBC1D14 pAb (ATL-HPA067398)

Atlas Antibodies

Catalog No.: ATL-HPA067398-25

Protein Description: TBC1 domain family, member 14
Gene Name: TBC1D14
Alternative Gene Name: KIAA1322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029192: 89%, ENSRNOG00000006400: 90%
Entrez Gene ID: 57533
Uniprot ID: Q9P2M4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APPAPSSTEREQSVRKSSTFPRTGYDSVKLYSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNEDILDLVVTSSSSAIVTLENDDDP
• Gene Sequence: APPAPSSTEREQSVRKSSTFPRTGYDSVKLYSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNEDILDLVVTSSSSAIVTLENDDDP
• Gene ID - Mouse: ENSMUSG00000029192
• Gene ID - Rat: ENSRNOG00000006400
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.