Anti TBC1D10C pAb (ATL-HPA069743 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA069743-25

• 
• 

Protein Description: TBC1 domain family, member 10C
Gene Name: TBC1D10C
Alternative Gene Name: Carabin, EPI64C, FLJ00332
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097708: 76%, ENSRNOG00000021510: 84%
Entrez Gene ID: 374403
Uniprot ID: Q8IV04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEM
• Gene Sequence: DLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEM
• Gene ID - Mouse: ENSMUSG00000097708
• Gene ID - Rat: ENSRNOG00000021510
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.