Anti TBC1D10A pAb (ATL-HPA076041)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076041-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TBC1D10A
Alternative Gene Name: AC004997.C22.2, EPI64, TBC1D10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034412: 65%, ENSRNOG00000006394: 67%
Entrez Gene ID: 83874
Uniprot ID: Q9BXI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL |
| Gene Sequence | KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL |
| Gene ID - Mouse | ENSMUSG00000034412 |
| Gene ID - Rat | ENSRNOG00000006394 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TBC1D10A pAb (ATL-HPA076041) | |
| Datasheet | Anti TBC1D10A pAb (ATL-HPA076041) Datasheet (External Link) |
| Vendor Page | Anti TBC1D10A pAb (ATL-HPA076041) at Atlas Antibodies |
| Documents & Links for Anti TBC1D10A pAb (ATL-HPA076041) | |
| Datasheet | Anti TBC1D10A pAb (ATL-HPA076041) Datasheet (External Link) |
| Vendor Page | Anti TBC1D10A pAb (ATL-HPA076041) |