Anti TBC1D10A pAb (ATL-HPA076041)

Atlas Antibodies

Catalog No.:
ATL-HPA076041-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TBC1 domain family, member 10A
Gene Name: TBC1D10A
Alternative Gene Name: AC004997.C22.2, EPI64, TBC1D10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034412: 65%, ENSRNOG00000006394: 67%
Entrez Gene ID: 83874
Uniprot ID: Q9BXI6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL
Gene Sequence KPKPPKQAQKEQRKQMKGRGQLEKPPAPNQAMVVAAAGDACPPQHVPPKDSAPKDSAPQDLAPQVSAHHRSQESLTSQESEDTYL
Gene ID - Mouse ENSMUSG00000034412
Gene ID - Rat ENSRNOG00000006394
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TBC1D10A pAb (ATL-HPA076041)
Datasheet Anti TBC1D10A pAb (ATL-HPA076041) Datasheet (External Link)
Vendor Page Anti TBC1D10A pAb (ATL-HPA076041) at Atlas Antibodies

Documents & Links for Anti TBC1D10A pAb (ATL-HPA076041)
Datasheet Anti TBC1D10A pAb (ATL-HPA076041) Datasheet (External Link)
Vendor Page Anti TBC1D10A pAb (ATL-HPA076041)