Anti TATDN2 pAb (ATL-HPA058001)

Atlas Antibodies

Catalog No.:
ATL-HPA058001-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TatD DNase domain containing 2
Gene Name: TATDN2
Alternative Gene Name: KIAA0218
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056952: 62%, ENSRNOG00000042482: 62%
Entrez Gene ID: 9797
Uniprot ID: Q93075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKVKHNWSSTSEGCPRKRSCLREPCDVAPSSRPAQRSASRSGGPSSPKRLKAQKEDDVACSRRLSWGSSRRRNNSSSS
Gene Sequence GKVKHNWSSTSEGCPRKRSCLREPCDVAPSSRPAQRSASRSGGPSSPKRLKAQKEDDVACSRRLSWGSSRRRNNSSSS
Gene ID - Mouse ENSMUSG00000056952
Gene ID - Rat ENSRNOG00000042482
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TATDN2 pAb (ATL-HPA058001)
Datasheet Anti TATDN2 pAb (ATL-HPA058001) Datasheet (External Link)
Vendor Page Anti TATDN2 pAb (ATL-HPA058001) at Atlas Antibodies

Documents & Links for Anti TATDN2 pAb (ATL-HPA058001)
Datasheet Anti TATDN2 pAb (ATL-HPA058001) Datasheet (External Link)
Vendor Page Anti TATDN2 pAb (ATL-HPA058001)