Anti TATDN1 pAb (ATL-HPA053045)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053045-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TATDN1
Alternative Gene Name: CDA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050891: 89%, ENSRNOG00000047198: 86%
Entrez Gene ID: 83940
Uniprot ID: Q6P1N9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMF |
Gene Sequence | MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMF |
Gene ID - Mouse | ENSMUSG00000050891 |
Gene ID - Rat | ENSRNOG00000047198 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TATDN1 pAb (ATL-HPA053045) | |
Datasheet | Anti TATDN1 pAb (ATL-HPA053045) Datasheet (External Link) |
Vendor Page | Anti TATDN1 pAb (ATL-HPA053045) at Atlas Antibodies |
Documents & Links for Anti TATDN1 pAb (ATL-HPA053045) | |
Datasheet | Anti TATDN1 pAb (ATL-HPA053045) Datasheet (External Link) |
Vendor Page | Anti TATDN1 pAb (ATL-HPA053045) |