Anti TATDN1 pAb (ATL-HPA053045)

Atlas Antibodies

Catalog No.: ATL-HPA053045-25

Protein Description: TatD DNase domain containing 1
Gene Name: TATDN1
Alternative Gene Name: CDA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050891: 89%, ENSRNOG00000047198: 86%
Entrez Gene ID: 83940
Uniprot ID: Q6P1N9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMF
• Gene Sequence: MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMF
• Gene ID - Mouse: ENSMUSG00000050891
• Gene ID - Rat: ENSRNOG00000047198
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.