Anti TATDN1 pAb (ATL-HPA053045)

Atlas Antibodies

Catalog No.:
ATL-HPA053045-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TatD DNase domain containing 1
Gene Name: TATDN1
Alternative Gene Name: CDA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050891: 89%, ENSRNOG00000047198: 86%
Entrez Gene ID: 83940
Uniprot ID: Q6P1N9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMF
Gene Sequence MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMF
Gene ID - Mouse ENSMUSG00000050891
Gene ID - Rat ENSRNOG00000047198
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TATDN1 pAb (ATL-HPA053045)
Datasheet Anti TATDN1 pAb (ATL-HPA053045) Datasheet (External Link)
Vendor Page Anti TATDN1 pAb (ATL-HPA053045) at Atlas Antibodies

Documents & Links for Anti TATDN1 pAb (ATL-HPA053045)
Datasheet Anti TATDN1 pAb (ATL-HPA053045) Datasheet (External Link)
Vendor Page Anti TATDN1 pAb (ATL-HPA053045)