Anti TAS2R38 pAb (ATL-HPA054366)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054366-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TAS2R38
Alternative Gene Name: PTC, T2R61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058250: 63%, ENSRNOG00000026225: 53%
Entrez Gene ID: 5726
Uniprot ID: P59533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NAKLRRAVMTILLWAQSSLKVRADHKADSRTL |
Gene Sequence | NAKLRRAVMTILLWAQSSLKVRADHKADSRTL |
Gene ID - Mouse | ENSMUSG00000058250 |
Gene ID - Rat | ENSRNOG00000026225 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TAS2R38 pAb (ATL-HPA054366) | |
Datasheet | Anti TAS2R38 pAb (ATL-HPA054366) Datasheet (External Link) |
Vendor Page | Anti TAS2R38 pAb (ATL-HPA054366) at Atlas Antibodies |
Documents & Links for Anti TAS2R38 pAb (ATL-HPA054366) | |
Datasheet | Anti TAS2R38 pAb (ATL-HPA054366) Datasheet (External Link) |
Vendor Page | Anti TAS2R38 pAb (ATL-HPA054366) |