Anti TAS2R38 pAb (ATL-HPA054366)

Atlas Antibodies

Catalog No.: ATL-HPA054366-25

Protein Description: taste receptor, type 2, member 38
Gene Name: TAS2R38
Alternative Gene Name: PTC, T2R61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058250: 63%, ENSRNOG00000026225: 53%
Entrez Gene ID: 5726
Uniprot ID: P59533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NAKLRRAVMTILLWAQSSLKVRADHKADSRTL
• Gene Sequence: NAKLRRAVMTILLWAQSSLKVRADHKADSRTL
• Gene ID - Mouse: ENSMUSG00000058250
• Gene ID - Rat: ENSRNOG00000026225
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.