Anti TAS1R3 pAb (ATL-HPA053439)

Atlas Antibodies

Catalog No.:
ATL-HPA053439-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: taste receptor, type 1, member 3
Gene Name: TAS1R3
Alternative Gene Name: T1R3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029072: 64%, ENSRNOG00000019589: 61%
Entrez Gene ID: 83756
Uniprot ID: Q7RTX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WLTSDLVMGLPGMAQMGTVLGFLQRGAQLHEFPQYVKTHLALATDPAFCSALGEREQGLEEDVVGQRCPQCDCITLQNVSAGLNHHQTFSVYAA
Gene Sequence WLTSDLVMGLPGMAQMGTVLGFLQRGAQLHEFPQYVKTHLALATDPAFCSALGEREQGLEEDVVGQRCPQCDCITLQNVSAGLNHHQTFSVYAA
Gene ID - Mouse ENSMUSG00000029072
Gene ID - Rat ENSRNOG00000019589
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TAS1R3 pAb (ATL-HPA053439)
Datasheet Anti TAS1R3 pAb (ATL-HPA053439) Datasheet (External Link)
Vendor Page Anti TAS1R3 pAb (ATL-HPA053439) at Atlas Antibodies

Documents & Links for Anti TAS1R3 pAb (ATL-HPA053439)
Datasheet Anti TAS1R3 pAb (ATL-HPA053439) Datasheet (External Link)
Vendor Page Anti TAS1R3 pAb (ATL-HPA053439)