Anti TAS1R1 pAb (ATL-HPA034579)

Atlas Antibodies

Catalog No.:
ATL-HPA034579-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: taste receptor, type 1, member 1
Gene Name: TAS1R1
Alternative Gene Name: GPR70, T1R1, TR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028950: 68%, ENSRNOG00000009708: 65%
Entrez Gene ID: 80835
Uniprot ID: Q7RTX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKEAPRPCHKGSWCSSNQLCRECQAFMAHTMPKLKAFSMSSAYNAYRAVYAVAH
Gene Sequence LSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKEAPRPCHKGSWCSSNQLCRECQAFMAHTMPKLKAFSMSSAYNAYRAVYAVAH
Gene ID - Mouse ENSMUSG00000028950
Gene ID - Rat ENSRNOG00000009708
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TAS1R1 pAb (ATL-HPA034579)
Datasheet Anti TAS1R1 pAb (ATL-HPA034579) Datasheet (External Link)
Vendor Page Anti TAS1R1 pAb (ATL-HPA034579) at Atlas Antibodies

Documents & Links for Anti TAS1R1 pAb (ATL-HPA034579)
Datasheet Anti TAS1R1 pAb (ATL-HPA034579) Datasheet (External Link)
Vendor Page Anti TAS1R1 pAb (ATL-HPA034579)