Anti TARSL2 pAb (ATL-HPA066697)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066697-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TARSL2
Alternative Gene Name: FLJ25005
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030515: 86%, ENSRNOG00000019023: 58%
Entrez Gene ID: 123283
Uniprot ID: A2RTX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTL |
Gene Sequence | VIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTL |
Gene ID - Mouse | ENSMUSG00000030515 |
Gene ID - Rat | ENSRNOG00000019023 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TARSL2 pAb (ATL-HPA066697) | |
Datasheet | Anti TARSL2 pAb (ATL-HPA066697) Datasheet (External Link) |
Vendor Page | Anti TARSL2 pAb (ATL-HPA066697) at Atlas Antibodies |
Documents & Links for Anti TARSL2 pAb (ATL-HPA066697) | |
Datasheet | Anti TARSL2 pAb (ATL-HPA066697) Datasheet (External Link) |
Vendor Page | Anti TARSL2 pAb (ATL-HPA066697) |