Anti TARSL2 pAb (ATL-HPA066697)

Atlas Antibodies

Catalog No.:
ATL-HPA066697-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: threonyl-tRNA synthetase-like 2
Gene Name: TARSL2
Alternative Gene Name: FLJ25005
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030515: 86%, ENSRNOG00000019023: 58%
Entrez Gene ID: 123283
Uniprot ID: A2RTX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTL
Gene Sequence VIPVGPTCEKYALQVSSEFFEEGFMADVDLDHSCTL
Gene ID - Mouse ENSMUSG00000030515
Gene ID - Rat ENSRNOG00000019023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TARSL2 pAb (ATL-HPA066697)
Datasheet Anti TARSL2 pAb (ATL-HPA066697) Datasheet (External Link)
Vendor Page Anti TARSL2 pAb (ATL-HPA066697) at Atlas Antibodies

Documents & Links for Anti TARSL2 pAb (ATL-HPA066697)
Datasheet Anti TARSL2 pAb (ATL-HPA066697) Datasheet (External Link)
Vendor Page Anti TARSL2 pAb (ATL-HPA066697)