Anti TARS2 pAb (ATL-HPA028626)

Atlas Antibodies

Catalog No.:
ATL-HPA028626-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: threonyl-tRNA synthetase 2, mitochondrial (putative)
Gene Name: TARS2
Alternative Gene Name: FLJ12528, TARSL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028107: 89%, ENSRNOG00000057194: 82%
Entrez Gene ID: 80222
Uniprot ID: Q9BW92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen HSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPVLERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIE
Gene Sequence HSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGKERTIRGSELPVLERICQELTAAARPFRRLEASRDQLRQLFKDNPFKLHLIE
Gene ID - Mouse ENSMUSG00000028107
Gene ID - Rat ENSRNOG00000057194
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TARS2 pAb (ATL-HPA028626)
Datasheet Anti TARS2 pAb (ATL-HPA028626) Datasheet (External Link)
Vendor Page Anti TARS2 pAb (ATL-HPA028626) at Atlas Antibodies

Documents & Links for Anti TARS2 pAb (ATL-HPA028626)
Datasheet Anti TARS2 pAb (ATL-HPA028626) Datasheet (External Link)
Vendor Page Anti TARS2 pAb (ATL-HPA028626)