Anti TARM1 pAb (ATL-HPA054401)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054401-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TARM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053338: 44%, ENSRNOG00000055581: 49%
Entrez Gene ID: 441864
Uniprot ID: B6A8C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RGVSFVLRKGGIILESPKPLDSTEGAAEFHLNNLKVRNAGEYTCEYYRKASPHILSQRSDVLLLLVTGHLSKPFLRTYQRGTVT |
Gene Sequence | RGVSFVLRKGGIILESPKPLDSTEGAAEFHLNNLKVRNAGEYTCEYYRKASPHILSQRSDVLLLLVTGHLSKPFLRTYQRGTVT |
Gene ID - Mouse | ENSMUSG00000053338 |
Gene ID - Rat | ENSRNOG00000055581 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TARM1 pAb (ATL-HPA054401) | |
Datasheet | Anti TARM1 pAb (ATL-HPA054401) Datasheet (External Link) |
Vendor Page | Anti TARM1 pAb (ATL-HPA054401) at Atlas Antibodies |
Documents & Links for Anti TARM1 pAb (ATL-HPA054401) | |
Datasheet | Anti TARM1 pAb (ATL-HPA054401) Datasheet (External Link) |
Vendor Page | Anti TARM1 pAb (ATL-HPA054401) |