Anti TARBP2 pAb (ATL-HPA061454)

Atlas Antibodies

Catalog No.:
ATL-HPA061454-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: TAR (HIV-1) RNA binding protein 2
Gene Name: TARBP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023051: 96%, ENSRNOG00000042355: 95%
Entrez Gene ID: 6895
Uniprot ID: Q15633
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSG
Gene Sequence PSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSG
Gene ID - Mouse ENSMUSG00000023051
Gene ID - Rat ENSRNOG00000042355
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TARBP2 pAb (ATL-HPA061454)
Datasheet Anti TARBP2 pAb (ATL-HPA061454) Datasheet (External Link)
Vendor Page Anti TARBP2 pAb (ATL-HPA061454) at Atlas Antibodies

Documents & Links for Anti TARBP2 pAb (ATL-HPA061454)
Datasheet Anti TARBP2 pAb (ATL-HPA061454) Datasheet (External Link)
Vendor Page Anti TARBP2 pAb (ATL-HPA061454)