Anti TAP2 pAb (ATL-HPA001312)

Atlas Antibodies

Catalog No.: ATL-HPA001312-25

Protein Description: transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
Gene Name: TAP2
Alternative Gene Name: ABCB3, D6S217E, PSF2, RING11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024339: 81%, ENSRNOG00000046031: 81%
Entrez Gene ID: 6891
Uniprot ID: Q03519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQA
• Gene Sequence: GSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQA
• Gene ID - Mouse: ENSMUSG00000024339
• Gene ID - Rat: ENSRNOG00000046031
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TAP2 pAb (ATL-HPA001312) – 3 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Feigenberg, Tomer; Clarke, Blaise; Virtanen, Carl; Plotkin, Anna; Letarte, Michelle; Rosen, Barry; Bernardini, Marcus Q; Kollara, Alexandra; Brown, Theodore J; Murphy, K Joan. Molecular profiling and clinical outcome of high-grade serous ovarian cancer presenting with low- versus high-volume ascites. Biomed Research International. 2014( 24982872):367103. 

Wang, Yutao; Yan, Kexin; Lin, Jiaxing; Li, Jun; Bi, Jianbin. Macrophage M2 Co-expression Factors Correlate With the Immune Microenvironment and Predict Outcome of Renal Clear Cell Carcinoma. Frontiers In Genetics. 12( 33692827):615655.