Anti TAP1 pAb (ATL-HPA072354)

Atlas Antibodies

SKU:
ATL-HPA072354-25
  • Immunofluorescent staining of human cell line HaCaT shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Gene Name: TAP1
Alternative Gene Name: ABCB2, D6S114E, PSF1, RING4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037321: 70%, ENSRNOG00000000457: 70%
Entrez Gene ID: 6890
Uniprot ID: Q03518
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK
Gene Sequence DDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK
Gene ID - Mouse ENSMUSG00000037321
Gene ID - Rat ENSRNOG00000000457
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TAP1 pAb (ATL-HPA072354)
Datasheet Anti TAP1 pAb (ATL-HPA072354) Datasheet (External Link)
Vendor Page Anti TAP1 pAb (ATL-HPA072354) at Atlas Antibodies

Documents & Links for Anti TAP1 pAb (ATL-HPA072354)
Datasheet Anti TAP1 pAb (ATL-HPA072354) Datasheet (External Link)
Vendor Page Anti TAP1 pAb (ATL-HPA072354)