Anti TAL1 pAb (ATL-HPA073983)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073983-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TAL1
Alternative Gene Name: bHLHa17, SCL, TCL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028717: 92%, ENSRNOG00000025051: 92%
Entrez Gene ID: 6886
Uniprot ID: P17542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG |
| Gene Sequence | PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG |
| Gene ID - Mouse | ENSMUSG00000028717 |
| Gene ID - Rat | ENSRNOG00000025051 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TAL1 pAb (ATL-HPA073983) | |
| Datasheet | Anti TAL1 pAb (ATL-HPA073983) Datasheet (External Link) |
| Vendor Page | Anti TAL1 pAb (ATL-HPA073983) at Atlas Antibodies |
| Documents & Links for Anti TAL1 pAb (ATL-HPA073983) | |
| Datasheet | Anti TAL1 pAb (ATL-HPA073983) Datasheet (External Link) |
| Vendor Page | Anti TAL1 pAb (ATL-HPA073983) |