Anti TAL1 pAb (ATL-HPA073983)

Atlas Antibodies

Catalog No.:
ATL-HPA073983-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: TAL bHLH transcription factor 1, erythroid differentiation factor
Gene Name: TAL1
Alternative Gene Name: bHLHa17, SCL, TCL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028717: 92%, ENSRNOG00000025051: 92%
Entrez Gene ID: 6886
Uniprot ID: P17542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG
Gene Sequence PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG
Gene ID - Mouse ENSMUSG00000028717
Gene ID - Rat ENSRNOG00000025051
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TAL1 pAb (ATL-HPA073983)
Datasheet Anti TAL1 pAb (ATL-HPA073983) Datasheet (External Link)
Vendor Page Anti TAL1 pAb (ATL-HPA073983) at Atlas Antibodies

Documents & Links for Anti TAL1 pAb (ATL-HPA073983)
Datasheet Anti TAL1 pAb (ATL-HPA073983) Datasheet (External Link)
Vendor Page Anti TAL1 pAb (ATL-HPA073983)