Anti TAL1 pAb (ATL-HPA073983)

Atlas Antibodies

SKU: ATL-HPA073983-25

• 

Protein Description: TAL bHLH transcription factor 1, erythroid differentiation factor
Gene Name: TAL1
Alternative Gene Name: bHLHa17, SCL, TCL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028717: 92%, ENSRNOG00000025051: 92%
Entrez Gene ID: 6886
Uniprot ID: P17542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG
• Gene Sequence: PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG
• Gene ID - Mouse: ENSMUSG00000028717
• Gene ID - Rat: ENSRNOG00000025051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.