Anti TAF9 pAb (ATL-HPA072658)

Atlas Antibodies

SKU:
ATL-HPA072658-25
  • Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TATA-box binding protein associated factor 9
Gene Name: TAF9
Alternative Gene Name: AD-004, CGI-137, MGC1603, MGC3647, MGC5067, TAF2G, TAFII31, TAFII32, TAFIID32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052293: 92%, ENSRNOG00000051258: 92%
Entrez Gene ID: 6880
Uniprot ID: Q16594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG
Gene Sequence ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG
Gene ID - Mouse ENSMUSG00000052293
Gene ID - Rat ENSRNOG00000051258
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TAF9 pAb (ATL-HPA072658)
Datasheet Anti TAF9 pAb (ATL-HPA072658) Datasheet (External Link)
Vendor Page Anti TAF9 pAb (ATL-HPA072658) at Atlas Antibodies

Documents & Links for Anti TAF9 pAb (ATL-HPA072658)
Datasheet Anti TAF9 pAb (ATL-HPA072658) Datasheet (External Link)
Vendor Page Anti TAF9 pAb (ATL-HPA072658)