Anti TAF1D pAb (ATL-HPA055935)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055935-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TAF1D
Alternative Gene Name: JOSD3, MGC5306, TAF(I)41
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031939: 61%, ENSRNOG00000010921: 57%
Entrez Gene ID: 79101
Uniprot ID: Q9H5J8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEESTAEDEDATHLEDNECDIKLAGDSFIVSSEFPVRLSVYLEEEDIT |
| Gene Sequence | ESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEESTAEDEDATHLEDNECDIKLAGDSFIVSSEFPVRLSVYLEEEDIT |
| Gene ID - Mouse | ENSMUSG00000031939 |
| Gene ID - Rat | ENSRNOG00000010921 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TAF1D pAb (ATL-HPA055935) | |
| Datasheet | Anti TAF1D pAb (ATL-HPA055935) Datasheet (External Link) |
| Vendor Page | Anti TAF1D pAb (ATL-HPA055935) at Atlas Antibodies |
| Documents & Links for Anti TAF1D pAb (ATL-HPA055935) | |
| Datasheet | Anti TAF1D pAb (ATL-HPA055935) Datasheet (External Link) |
| Vendor Page | Anti TAF1D pAb (ATL-HPA055935) |