Anti TAF1C pAb (ATL-HPA072229)

Atlas Antibodies

SKU:
ATL-HPA072229-25
  • Immunofluorescent staining of human cell line HaCaT shows localization to nucleus & nucleoli fibrillar center.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa
Gene Name: TAF1C
Alternative Gene Name: MGC:39976, SL1, TAFI110, TAFI95
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031832: 81%, ENSRNOG00000015632: 78%
Entrez Gene ID: 9013
Uniprot ID: Q15572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDE
Gene Sequence FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDE
Gene ID - Mouse ENSMUSG00000031832
Gene ID - Rat ENSRNOG00000015632
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TAF1C pAb (ATL-HPA072229)
Datasheet Anti TAF1C pAb (ATL-HPA072229) Datasheet (External Link)
Vendor Page Anti TAF1C pAb (ATL-HPA072229) at Atlas Antibodies

Documents & Links for Anti TAF1C pAb (ATL-HPA072229)
Datasheet Anti TAF1C pAb (ATL-HPA072229) Datasheet (External Link)
Vendor Page Anti TAF1C pAb (ATL-HPA072229)