Anti TACO1 pAb (ATL-HPA021626 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021626-25

Protein Description: translational activator of mitochondrially encoded cytochrome c oxidase I
Gene Name: TACO1
Alternative Gene Name: CCDC44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001983: 90%, ENSRNOG00000008405: 93%
Entrez Gene ID: 51204
Uniprot ID: Q9BSH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLIQALSNHEDVIHVYDNI
• Gene Sequence: FKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLIQALSNHEDVIHVYDNI
• Gene ID - Mouse: ENSMUSG00000001983
• Gene ID - Rat: ENSRNOG00000008405
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.