Anti TACC2 pAb (ATL-HPA061394)

Atlas Antibodies

Catalog No.:
ATL-HPA061394-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transforming, acidic coiled-coil containing protein 2
Gene Name: TACC2
Alternative Gene Name: AZU-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030852: 90%, ENSRNOG00000020457: 90%
Entrez Gene ID: 10579
Uniprot ID: O95359
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSTFVNETKFSSPTEELDYRNSYEIEYMEKIGSSLPQDDDAPKKQALYLMFDTSQESPVKSSPVRMSESPTPCSGSSF
Gene Sequence LSTFVNETKFSSPTEELDYRNSYEIEYMEKIGSSLPQDDDAPKKQALYLMFDTSQESPVKSSPVRMSESPTPCSGSSF
Gene ID - Mouse ENSMUSG00000030852
Gene ID - Rat ENSRNOG00000020457
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TACC2 pAb (ATL-HPA061394)
Datasheet Anti TACC2 pAb (ATL-HPA061394) Datasheet (External Link)
Vendor Page Anti TACC2 pAb (ATL-HPA061394) at Atlas Antibodies

Documents & Links for Anti TACC2 pAb (ATL-HPA061394)
Datasheet Anti TACC2 pAb (ATL-HPA061394) Datasheet (External Link)
Vendor Page Anti TACC2 pAb (ATL-HPA061394)