Anti TAC3 pAb (ATL-HPA045919 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045919-25
  • Immunohistochemical staining of human Placenta shows weak cytoplasmic positivity in syncytiotrophoblast.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and TAC3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415710).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tachykinin 3
Gene Name: TAC3
Alternative Gene Name: NKB, NKNB, ZNEUROK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025400: 62%, ENSRNOG00000004229: 59%
Entrez Gene ID: 6866
Uniprot ID: Q9UHF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen GAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLM
Gene Sequence GAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLM
Gene ID - Mouse ENSMUSG00000025400
Gene ID - Rat ENSRNOG00000004229
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TAC3 pAb (ATL-HPA045919 w/enhanced validation)
Datasheet Anti TAC3 pAb (ATL-HPA045919 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TAC3 pAb (ATL-HPA045919 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TAC3 pAb (ATL-HPA045919 w/enhanced validation)
Datasheet Anti TAC3 pAb (ATL-HPA045919 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TAC3 pAb (ATL-HPA045919 w/enhanced validation)