Anti TAC3 pAb (ATL-HPA045919 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045919-25

• 
• 
• 

Protein Description: tachykinin 3
Gene Name: TAC3
Alternative Gene Name: NKB, NKNB, ZNEUROK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025400: 62%, ENSRNOG00000004229: 59%
Entrez Gene ID: 6866
Uniprot ID: Q9UHF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLM
• Gene Sequence: GAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLM
• Gene ID - Mouse: ENSMUSG00000025400
• Gene ID - Rat: ENSRNOG00000004229
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.