Anti TAB2 pAb (ATL-HPA071215)

Atlas Antibodies

Catalog No.:
ATL-HPA071215-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: TGF-beta activated kinase 1/MAP3K7 binding protein 2
Gene Name: TAB2
Alternative Gene Name: KIAA0733, MAP3K7IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015755: 96%, ENSRNOG00000016054: 94%
Entrez Gene ID: 23118
Uniprot ID: Q9NYJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTLNRNQPTVY
Gene Sequence GSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTLNRNQPTVY
Gene ID - Mouse ENSMUSG00000015755
Gene ID - Rat ENSRNOG00000016054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TAB2 pAb (ATL-HPA071215)
Datasheet Anti TAB2 pAb (ATL-HPA071215) Datasheet (External Link)
Vendor Page Anti TAB2 pAb (ATL-HPA071215) at Atlas Antibodies

Documents & Links for Anti TAB2 pAb (ATL-HPA071215)
Datasheet Anti TAB2 pAb (ATL-HPA071215) Datasheet (External Link)
Vendor Page Anti TAB2 pAb (ATL-HPA071215)