Anti TAB1 pAb (ATL-HPA057104)

Atlas Antibodies

Catalog No.:
ATL-HPA057104-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: TGF-beta activated kinase 1/MAP3K7 binding protein 1
Gene Name: TAB1
Alternative Gene Name: MAP3K7IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022414: 99%, ENSRNOG00000017285: 97%
Entrez Gene ID: 10454
Uniprot ID: Q15750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQ
Gene Sequence EQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQ
Gene ID - Mouse ENSMUSG00000022414
Gene ID - Rat ENSRNOG00000017285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TAB1 pAb (ATL-HPA057104)
Datasheet Anti TAB1 pAb (ATL-HPA057104) Datasheet (External Link)
Vendor Page Anti TAB1 pAb (ATL-HPA057104) at Atlas Antibodies

Documents & Links for Anti TAB1 pAb (ATL-HPA057104)
Datasheet Anti TAB1 pAb (ATL-HPA057104) Datasheet (External Link)
Vendor Page Anti TAB1 pAb (ATL-HPA057104)