Anti SYTL4 pAb (ATL-HPA075138)

Atlas Antibodies

Catalog No.:
ATL-HPA075138-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: synaptotagmin like 4
Gene Name: SYTL4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031255: 91%, ENSRNOG00000003526: 91%
Entrez Gene ID: 94121
Uniprot ID: Q96C24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIK
Gene Sequence NTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIK
Gene ID - Mouse ENSMUSG00000031255
Gene ID - Rat ENSRNOG00000003526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYTL4 pAb (ATL-HPA075138)
Datasheet Anti SYTL4 pAb (ATL-HPA075138) Datasheet (External Link)
Vendor Page Anti SYTL4 pAb (ATL-HPA075138) at Atlas Antibodies

Documents & Links for Anti SYTL4 pAb (ATL-HPA075138)
Datasheet Anti SYTL4 pAb (ATL-HPA075138) Datasheet (External Link)
Vendor Page Anti SYTL4 pAb (ATL-HPA075138)