Anti SYTL3 pAb (ATL-HPA030584)

Atlas Antibodies

Catalog No.:
ATL-HPA030584-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: synaptotagmin-like 3
Gene Name: SYTL3
Alternative Gene Name: exophilin-6, SLP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041831: 75%, ENSRNOG00000018321: 75%
Entrez Gene ID: 94120
Uniprot ID: Q4VX76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALKELEREAILQVLYRDQAVQNTEEERTRKLKTHLQHLRWKGAKNTDWEHKEKCCARCQQVLGFLLHRGAVCRGCSHRVCAQCR
Gene Sequence ALKELEREAILQVLYRDQAVQNTEEERTRKLKTHLQHLRWKGAKNTDWEHKEKCCARCQQVLGFLLHRGAVCRGCSHRVCAQCR
Gene ID - Mouse ENSMUSG00000041831
Gene ID - Rat ENSRNOG00000018321
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYTL3 pAb (ATL-HPA030584)
Datasheet Anti SYTL3 pAb (ATL-HPA030584) Datasheet (External Link)
Vendor Page Anti SYTL3 pAb (ATL-HPA030584) at Atlas Antibodies

Documents & Links for Anti SYTL3 pAb (ATL-HPA030584)
Datasheet Anti SYTL3 pAb (ATL-HPA030584) Datasheet (External Link)
Vendor Page Anti SYTL3 pAb (ATL-HPA030584)