Anti SYT8 pAb (ATL-HPA052700)

Atlas Antibodies

Catalog No.:
ATL-HPA052700-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: synaptotagmin VIII
Gene Name: SYT8
Alternative Gene Name: DKFZp434K0322
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031098: 40%, ENSRNOG00000029590: 38%
Entrez Gene ID: 90019
Uniprot ID: Q8NBV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGWQTMQGRKMGHPPVSPSAPAPAGTTAIPGLIPDLVAGT
Gene Sequence HGWQTMQGRKMGHPPVSPSAPAPAGTTAIPGLIPDLVAGT
Gene ID - Mouse ENSMUSG00000031098
Gene ID - Rat ENSRNOG00000029590
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYT8 pAb (ATL-HPA052700)
Datasheet Anti SYT8 pAb (ATL-HPA052700) Datasheet (External Link)
Vendor Page Anti SYT8 pAb (ATL-HPA052700) at Atlas Antibodies

Documents & Links for Anti SYT8 pAb (ATL-HPA052700)
Datasheet Anti SYT8 pAb (ATL-HPA052700) Datasheet (External Link)
Vendor Page Anti SYT8 pAb (ATL-HPA052700)