Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA078390-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SYT5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004961: 84%, ENSRNOG00000018217: 86%
Entrez Gene ID: 6861
Uniprot ID: O00445
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPS |
| Gene Sequence | CRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPS |
| Gene ID - Mouse | ENSMUSG00000004961 |
| Gene ID - Rat | ENSRNOG00000018217 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation) | |
| Datasheet | Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation) | |
| Datasheet | Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SYT5 pAb (ATL-HPA078390 w/enhanced validation) |