Anti SYT15 pAb (ATL-HPA064559)
Atlas Antibodies
- SKU:
- ATL-HPA064559-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SYT15
Alternative Gene Name: CHR10SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041479: 82%, ENSRNOG00000051688: 85%
Entrez Gene ID: 83849
Uniprot ID: Q9BQS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPLKNETLVGDCRRVIWRDLEAESL |
Gene Sequence | QFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPLKNETLVGDCRRVIWRDLEAESL |
Gene ID - Mouse | ENSMUSG00000041479 |
Gene ID - Rat | ENSRNOG00000051688 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SYT15 pAb (ATL-HPA064559) | |
Datasheet | Anti SYT15 pAb (ATL-HPA064559) Datasheet (External Link) |
Vendor Page | Anti SYT15 pAb (ATL-HPA064559) at Atlas Antibodies |
Documents & Links for Anti SYT15 pAb (ATL-HPA064559) | |
Datasheet | Anti SYT15 pAb (ATL-HPA064559) Datasheet (External Link) |
Vendor Page | Anti SYT15 pAb (ATL-HPA064559) |