Anti SYT15 pAb (ATL-HPA064559)

Atlas Antibodies

Catalog No.:
ATL-HPA064559-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: synaptotagmin XV
Gene Name: SYT15
Alternative Gene Name: CHR10SYT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041479: 82%, ENSRNOG00000051688: 85%
Entrez Gene ID: 83849
Uniprot ID: Q9BQS2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPLKNETLVGDCRRVIWRDLEAESL
Gene Sequence QFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPLKNETLVGDCRRVIWRDLEAESL
Gene ID - Mouse ENSMUSG00000041479
Gene ID - Rat ENSRNOG00000051688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYT15 pAb (ATL-HPA064559)
Datasheet Anti SYT15 pAb (ATL-HPA064559) Datasheet (External Link)
Vendor Page Anti SYT15 pAb (ATL-HPA064559) at Atlas Antibodies

Documents & Links for Anti SYT15 pAb (ATL-HPA064559)
Datasheet Anti SYT15 pAb (ATL-HPA064559) Datasheet (External Link)
Vendor Page Anti SYT15 pAb (ATL-HPA064559)