Anti SYT13 pAb (ATL-HPA056602)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056602-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SYT13
Alternative Gene Name: KIAA1427
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027220: 96%, ENSRNOG00000008000: 98%
Entrez Gene ID: 57586
Uniprot ID: Q7L8C5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KDVSVKVTLKHQARKLKKKQTKRAKHKINPVWNEMIMFELPDDLLQASSVE |
Gene Sequence | KDVSVKVTLKHQARKLKKKQTKRAKHKINPVWNEMIMFELPDDLLQASSVE |
Gene ID - Mouse | ENSMUSG00000027220 |
Gene ID - Rat | ENSRNOG00000008000 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SYT13 pAb (ATL-HPA056602) | |
Datasheet | Anti SYT13 pAb (ATL-HPA056602) Datasheet (External Link) |
Vendor Page | Anti SYT13 pAb (ATL-HPA056602) at Atlas Antibodies |
Documents & Links for Anti SYT13 pAb (ATL-HPA056602) | |
Datasheet | Anti SYT13 pAb (ATL-HPA056602) Datasheet (External Link) |
Vendor Page | Anti SYT13 pAb (ATL-HPA056602) |