Anti SYT12 pAb (ATL-HPA074255)

Atlas Antibodies

Catalog No.:
ATL-HPA074255-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: synaptotagmin 12
Gene Name: SYT12
Alternative Gene Name: SRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049303: 99%, ENSRNOG00000019306: 99%
Entrez Gene ID: 91683
Uniprot ID: Q8IV01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSIPLDPTALEEKSLRFSVFGIDEDERNVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKAADA
Gene Sequence FESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSIPLDPTALEEKSLRFSVFGIDEDERNVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKAADA
Gene ID - Mouse ENSMUSG00000049303
Gene ID - Rat ENSRNOG00000019306
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYT12 pAb (ATL-HPA074255)
Datasheet Anti SYT12 pAb (ATL-HPA074255) Datasheet (External Link)
Vendor Page Anti SYT12 pAb (ATL-HPA074255) at Atlas Antibodies

Documents & Links for Anti SYT12 pAb (ATL-HPA074255)
Datasheet Anti SYT12 pAb (ATL-HPA074255) Datasheet (External Link)
Vendor Page Anti SYT12 pAb (ATL-HPA074255)