Anti SYT12 pAb (ATL-HPA074255)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074255-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SYT12
Alternative Gene Name: SRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049303: 99%, ENSRNOG00000019306: 99%
Entrez Gene ID: 91683
Uniprot ID: Q8IV01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSIPLDPTALEEKSLRFSVFGIDEDERNVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKAADA |
Gene Sequence | FESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSIPLDPTALEEKSLRFSVFGIDEDERNVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKAADA |
Gene ID - Mouse | ENSMUSG00000049303 |
Gene ID - Rat | ENSRNOG00000019306 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SYT12 pAb (ATL-HPA074255) | |
Datasheet | Anti SYT12 pAb (ATL-HPA074255) Datasheet (External Link) |
Vendor Page | Anti SYT12 pAb (ATL-HPA074255) at Atlas Antibodies |
Documents & Links for Anti SYT12 pAb (ATL-HPA074255) | |
Datasheet | Anti SYT12 pAb (ATL-HPA074255) Datasheet (External Link) |
Vendor Page | Anti SYT12 pAb (ATL-HPA074255) |