Anti SYPL2 pAb (ATL-HPA076657)

Atlas Antibodies

Catalog No.:
ATL-HPA076657-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: synaptophysin like 2
Gene Name: SYPL2
Alternative Gene Name: Mg29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027887: 78%, ENSRNOG00000019780: 78%
Entrez Gene ID: 284612
Uniprot ID: Q5VXT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVE
Gene Sequence FKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVE
Gene ID - Mouse ENSMUSG00000027887
Gene ID - Rat ENSRNOG00000019780
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYPL2 pAb (ATL-HPA076657)
Datasheet Anti SYPL2 pAb (ATL-HPA076657) Datasheet (External Link)
Vendor Page Anti SYPL2 pAb (ATL-HPA076657) at Atlas Antibodies

Documents & Links for Anti SYPL2 pAb (ATL-HPA076657)
Datasheet Anti SYPL2 pAb (ATL-HPA076657) Datasheet (External Link)
Vendor Page Anti SYPL2 pAb (ATL-HPA076657)