Anti SYP pAb (ATL-HPA002858 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002858-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: synaptophysin
Gene Name: SYP
Alternative Gene Name: MRX96
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031144: 83%, ENSRNOG00000019780: 37%
Entrez Gene ID: 6855
Uniprot ID: P08247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL
Gene Sequence DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL
Gene ID - Mouse ENSMUSG00000031144
Gene ID - Rat ENSRNOG00000019780
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SYP pAb (ATL-HPA002858 w/enhanced validation)
Datasheet Anti SYP pAb (ATL-HPA002858 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SYP pAb (ATL-HPA002858 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SYP pAb (ATL-HPA002858 w/enhanced validation)
Datasheet Anti SYP pAb (ATL-HPA002858 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SYP pAb (ATL-HPA002858 w/enhanced validation)