Anti SYNJ1 pAb (ATL-HPA011916 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011916-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SYNJ1
Alternative Gene Name: INPP5G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022973: 95%, ENSRNOG00000002051: 95%
Entrez Gene ID: 8867
Uniprot ID: O43426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQS |
| Gene Sequence | ASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQS |
| Gene ID - Mouse | ENSMUSG00000022973 |
| Gene ID - Rat | ENSRNOG00000002051 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SYNJ1 pAb (ATL-HPA011916 w/enhanced validation) | |
| Datasheet | Anti SYNJ1 pAb (ATL-HPA011916 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SYNJ1 pAb (ATL-HPA011916 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SYNJ1 pAb (ATL-HPA011916 w/enhanced validation) | |
| Datasheet | Anti SYNJ1 pAb (ATL-HPA011916 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SYNJ1 pAb (ATL-HPA011916 w/enhanced validation) |
| Citations for Anti SYNJ1 pAb (ATL-HPA011916 w/enhanced validation) – 4 Found |
| Vivas, Oscar; Tiscione, Scott A; Dixon, Rose E; Ory, Daniel S; Dickson, Eamonn J. Niemann-Pick Type C Disease Reveals a Link between Lysosomal Cholesterol and PtdIns(4,5)P(2) That Regulates Neuronal Excitability. Cell Reports. 2019;27(9):2636-2648.e4. PubMed |
| Ando, Kunie; Ndjim, Marième; Turbant, Sabrina; Fontaine, Gaëlle; Pregoni, Gustavo; Dauphinot, Luce; Yilmaz, Zehra; Suain, Valérie; Mansour, Salwa; Authelet, Michèle; De Dekker, Robert; Leroy, Karelle; Delatour, Benoît; Duyckaerts, Charles; Potier, Marie-Claude; Brion, Jean-Pierre. The lipid phosphatase Synaptojanin 1 undergoes a significant alteration in expression and solubility and is associated with brain lesions in Alzheimer's disease. Acta Neuropathologica Communications. 2020;8(1):79. PubMed |
| Wu, Chun-I; Vinton, Elizabeth A; Pearse, Richard V 2nd; Heo, Keunjung; Aylward, Aimee J; Hsieh, Yi-Chen; Bi, Yan; Adeleye, Sopefoluwa; Fancher, Seeley; Duong, Duc M; Seyfried, Nicholas T; Schwarz, Thomas L; Young-Pearse, Tracy L. APP and DYRK1A regulate axonal and synaptic vesicle protein networks and mediate Alzheimer's pathology in trisomy 21 neurons. Molecular Psychiatry. 2022;27(4):1970-1989. PubMed |
| Ng, Xin Yi; Wu, Yumei; Lin, Youneng; Yaqoob, Sidra Mohamed; Greene, Lois E; De Camilli, Pietro; Cao, Mian. Mutations in Parkinsonism-linked endocytic proteins synaptojanin1 and auxilin have synergistic effects on dopaminergic axonal pathology. Npj Parkinson's Disease. 2023;9(1):26. PubMed |