Anti SYNJ1 pAb (ATL-HPA011916 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011916-25

Protein Description: synaptojanin 1
Gene Name: SYNJ1
Alternative Gene Name: INPP5G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022973: 95%, ENSRNOG00000002051: 95%
Entrez Gene ID: 8867
Uniprot ID: O43426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQS
• Gene Sequence: ASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQS
• Gene ID - Mouse: ENSMUSG00000022973
• Gene ID - Rat: ENSRNOG00000002051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SYNJ1 pAb (ATL-HPA011916 w/enhanced validation) – 4 Found

Vivas, Oscar; Tiscione, Scott A; Dixon, Rose E; Ory, Daniel S; Dickson, Eamonn J. Niemann-Pick Type C Disease Reveals a Link between Lysosomal Cholesterol and PtdIns(4,5)P(2) That Regulates Neuronal Excitability. Cell Reports. 2019;27(9):2636-2648.e4. 

Ando, Kunie; Ndjim, Marième; Turbant, Sabrina; Fontaine, Gaëlle; Pregoni, Gustavo; Dauphinot, Luce; Yilmaz, Zehra; Suain, Valérie; Mansour, Salwa; Authelet, Michèle; De Dekker, Robert; Leroy, Karelle; Delatour, Benoît; Duyckaerts, Charles; Potier, Marie-Claude; Brion, Jean-Pierre. The lipid phosphatase Synaptojanin 1 undergoes a significant alteration in expression and solubility and is associated with brain lesions in Alzheimer's disease. Acta Neuropathologica Communications. 2020;8(1):79. 

Wu, Chun-I; Vinton, Elizabeth A; Pearse, Richard V 2nd; Heo, Keunjung; Aylward, Aimee J; Hsieh, Yi-Chen; Bi, Yan; Adeleye, Sopefoluwa; Fancher, Seeley; Duong, Duc M; Seyfried, Nicholas T; Schwarz, Thomas L; Young-Pearse, Tracy L. APP and DYRK1A regulate axonal and synaptic vesicle protein networks and mediate Alzheimer's pathology in trisomy 21 neurons. Molecular Psychiatry. 2022;27(4):1970-1989. 

Ng, Xin Yi; Wu, Yumei; Lin, Youneng; Yaqoob, Sidra Mohamed; Greene, Lois E; De Camilli, Pietro; Cao, Mian. Mutations in Parkinsonism-linked endocytic proteins synaptojanin1 and auxilin have synergistic effects on dopaminergic axonal pathology. Npj Parkinson's Disease. 2023;9(1):26.