Anti SYNE2 pAb (ATL-HPA003435 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003435-25

Protein Description: spectrin repeat containing, nuclear envelope 2
Gene Name: SYNE2
Alternative Gene Name: DKFZP434H2235, KIAA1011, Nesp2, Nesprin-2, NUA, NUANCE, SYNE-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063450: 56%, ENSRNOG00000014059: 29%
Entrez Gene ID: 23224
Uniprot ID: Q8WXH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYRVDVGNPEESLEMPLRKQEELESTVARIQDLTEKLGMISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETEAE
• Gene Sequence: NVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYRVDVGNPEESLEMPLRKQEELESTVARIQDLTEKLGMISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETEAE
• Gene ID - Mouse: ENSMUSG00000063450
• Gene ID - Rat: ENSRNOG00000014059
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SYNE2 pAb (ATL-HPA003435 w/enhanced validation) – 1 Found

Versaevel, Marie; Braquenier, Jean-Baptiste; Riaz, Maryam; Grevesse, Thomas; Lantoine, Joséphine; Gabriele, Sylvain. Super-resolution microscopy reveals LINC complex recruitment at nuclear indentation sites. Scientific Reports. 2014;4( 25482017):7362.