Anti SYCP3 pAb (ATL-HPA039635 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039635-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SYCP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020059: 78%, ENSRNOG00000005270: 78%
Entrez Gene ID: 50511
Uniprot ID: Q8IZU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF |
| Gene Sequence | ILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF |
| Gene ID - Mouse | ENSMUSG00000020059 |
| Gene ID - Rat | ENSRNOG00000005270 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SYCP3 pAb (ATL-HPA039635 w/enhanced validation) | |
| Datasheet | Anti SYCP3 pAb (ATL-HPA039635 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SYCP3 pAb (ATL-HPA039635 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SYCP3 pAb (ATL-HPA039635 w/enhanced validation) | |
| Datasheet | Anti SYCP3 pAb (ATL-HPA039635 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SYCP3 pAb (ATL-HPA039635 w/enhanced validation) |
| Citations for Anti SYCP3 pAb (ATL-HPA039635 w/enhanced validation) – 3 Found |
| de Michele, Francesca; Poels, Jonathan; Vermeulen, Maxime; Ambroise, Jérôme; Gruson, Damien; Guiot, Yves; Wyns, Christine. Haploid Germ Cells Generated in Organotypic Culture of Testicular Tissue From Prepubertal Boys. Frontiers In Physiology. 9( 30356879):1413. PubMed |
| Lecante, Laetitia L; Leverrier-Penna, Sabrina; Gicquel, Thomas; Giton, Frank; Costet, Nathalie; Desdoits-Lethimonier, Christèle; Lesné, Laurianne; Fromenty, Bernard; Lavoué, Vincent; Rolland, Antoine D; Mazaud-Guittot, Séverine. Acetaminophen (APAP, Paracetamol) Interferes With the First Trimester Human Fetal Ovary Development in an Ex Vivo Model. The Journal Of Clinical Endocrinology And Metabolism. 2022;107(6):1647-1661. PubMed |
| Lobo, João; Constâncio, Vera; Guimarães-Teixeira, Catarina; Leite-Silva, Pedro; Miranda-Gonçalves, Vera; Sequeira, José Pedro; Pistoni, Laura; Guimarães, Rita; Cantante, Mariana; Braga, Isaac; Maurício, Joaquina; Looijenga, Leendert H J; Henrique, Rui; Jerónimo, Carmen. Promoter methylation of DNA homologous recombination genes is predictive of the responsiveness to PARP inhibitor treatment in testicular germ cell tumors. Molecular Oncology. 2021;15(4):846-865. PubMed |